| Basic Information | |
|---|---|
| Taxon OID | 3300001678 Open in IMG/M |
| Scaffold ID | Mariner_1037475 Open in IMG/M |
| Source Dataset Name | Black smokers hydrothermal plume microbial communities from Mariner, Lau Basin, Pacific Ocean -IDBA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1338 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Mariner, Lau Basin, Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mariner, Lau Basin, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -20.180059 | Long. (o) | -176.601242 | Alt. (m) | Depth (m) | 1900 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002667 | Metagenome | 539 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Mariner_10374752 | F002667 | N/A | MEEILSSALILVACISGGVSCMFIARSRSTTNKHSRQRIKDFENDIRYLAESKKEEAKDYRQEILRLKGTLNKMKQGVTVTDTDMKNSGLGEVLMQLIPGKYRKAASFLIPQVEEAVKKDPALIEKVYEKIKSANTTSNKQTEPGTEAEGIQTL* |
| ⦗Top⦘ |