Scaffold Mariner_1004988

Overview

Basic Information

• Taxon OID: 3300001678
• Scaffold ID: Mariner_1004988
• Source Dataset Name: Black smokers hydrothermal plume microbial communities from Mariner, Lau Basin, Pacific Ocean -IDBA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4968
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Mariner, Lau Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Mariner, Lau Basin, Pacific Ocean
• Coordinates
  • Lat. (^o): -20.180059
  • Long. (^o): -176.601242
  • Depth (m): 1900

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042643	Metagenome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Mariner_100498810	F042643	N/A	MAFKLKTGKTINKVLAGAGVVALLGIVGNAVAPGFMSSTMGKAVEGIAAYSVGGVESVIGAAATMFIGPGSRGSTALDNTLTQTL*