| Basic Information | |
|---|---|
| Taxon OID | 3300001676 Open in IMG/M |
| Scaffold ID | TuiMalila_1010585 Open in IMG/M |
| Source Dataset Name | Black smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2545 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tui Malila, Lau Basin, Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tui Malila, Lau Basin, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -21.99002 | Long. (o) | -176.568744 | Alt. (m) | Depth (m) | 2000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065130 | Metagenome | 128 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TuiMalila_10105851 | F065130 | AGGAGG | MSRTRRSAQELIEESEARLAKLREKAALDQAKQSPELAPIVEAIKENSEAITESQRGLGAGPQSFESRAAKHEAWLEEITAAEDLAELILAQAQERKDYLTSALAYMAQSVFEGKDISVDILETLASIPTSPVLEDAMIKY |
| ⦗Top⦘ |