NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TuiMalila_1007020

Scaffold TuiMalila_1007020


Overview

Basic Information
Taxon OID3300001676 Open in IMG/M
Scaffold IDTuiMalila_1007020 Open in IMG/M
Source Dataset NameBlack smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3313
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tui Malila, Lau Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameTui Malila, Lau Basin, Pacific Ocean
CoordinatesLat. (o)-21.99002Long. (o)-176.568744Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087941Metagenome110Y

Sequences

Protein IDFamilyRBSSequence
TuiMalila_10070202F087941GGAGGMPEHHEHDEESFPEQLKRLLIDNAFAFTIGWLVGRGYVIDLLSDIAGALT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.