Scaffold TuiMalila_1004719

Overview

Basic Information

• Taxon OID: 3300001676
• Scaffold ID: TuiMalila_1004719
• Source Dataset Name: Black smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4242
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tui Malila, Lau Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Tui Malila, Lau Basin, Pacific Ocean
• Coordinates
  • Lat. (^o): -21.99002
  • Long. (^o): -176.568744
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037935	Metagenome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
TuiMalila_10047191	F037935	N/A	STPIAKKTVLLLFIFEVGGYLKIFEIQHNKPLLYLYFTYEI*