Scaffold TuiMalila_1001048

Overview

Basic Information

• Taxon OID: 3300001676
• Scaffold ID: TuiMalila_1001048
• Source Dataset Name: Black smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9663
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tui Malila, Lau Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Tui Malila, Lau Basin, Pacific Ocean
• Coordinates
  • Lat. (^o): -21.99002
  • Long. (^o): -176.568744
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038276	Metagenome	166	N

Sequences

Protein ID	Family	RBS	Sequence
TuiMalila_100104812	F038276	AGTAG	MNLDFLLRLTNYVNICKQIYLAVIKQFLTVLVIINHACVLLHGNHNYKDVFYDRLSNQYIRNACDFHNLHISYNNLGLVLEKFLLYIKIINNKV*