Scaffold P5cmW16_1027462

Overview

Basic Information

• Taxon OID: 3300001664
• Scaffold ID: P5cmW16_1027462
• Source Dataset Name: Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1069
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)

Source Dataset Sampling Location

• Location Name: Axel Heiberg Island, Nunavut, Canada
• Coordinates
  • Lat. (^o): 79.26
  • Long. (^o): -90.46

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027367	Metagenome / Metatranscriptome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
P5cmW16_10274622	F027367	N/A	LALVAFYLVTGLARGQIGYEQSGAGRYVYVGAVFWLILLGDAARRVPWRGTWRPALVALVFLSCFNSGAVLVEFGTAKDAQMQRQVADLQALADVRDNPCLNPSGAVDPLVMPAETSPALYYRAIDRFGDPSARQPVRDPAAFDQARTNLLRPGCR*