| Basic Information | |
|---|---|
| Taxon OID | 3300001661 Open in IMG/M |
| Scaffold ID | JGI12053J15887_10372072 Open in IMG/M |
| Source Dataset Name | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 689 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | El Dorado National Forest, Georgetown, California, USA | |||||||
| Coordinates | Lat. (o) | 38.88 | Long. (o) | -120.64 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011490 | Metagenome / Metatranscriptome | 290 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI12053J15887_103720722 | F011490 | AGG | MDEEKVKKCLHDLNNRVGMILANAELMQLEQLSAKARERTKLIEAKSLELRQLIRDIGDHLFD* |
| ⦗Top⦘ |