NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12053J15887_10142859

Scaffold JGI12053J15887_10142859


Overview

Basic Information
Taxon OID3300001661 Open in IMG/M
Scaffold IDJGI12053J15887_10142859 Open in IMG/M
Source Dataset NameMediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1263
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameEl Dorado National Forest, Georgetown, California, USA
CoordinatesLat. (o)38.88Long. (o)-120.64Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009833Metagenome / Metatranscriptome312Y
F079644Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
JGI12053J15887_101428592F079644GGAGGMYPGYQPKPDDVFHAVGYTTRDISDNTHFHLHRISDRVRMENENLWRQLGPLVHAMQSGKVKREFVEVLSVDPFLGNYEMPYTGPHKEIFLSIEYLSDAAFRLCREYGIRHPDVIEKVKRADIPGNHGITVRTVHYSRI*
JGI12053J15887_101428593F009833GGAGGMHSPFEILRKNPAGSFRRFEPVSDFASASIRIKELTTLSPGEYVVFDQRTHNDIAARSSFWVDPRRE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.