Scaffold JGI12053J15887_10105407

Overview

Basic Information

• Taxon OID: 3300001661
• Scaffold ID: JGI12053J15887_10105407
• Source Dataset Name: Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1523
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: El Dorado National Forest, Georgetown, California, USA
• Coordinates
  • Lat. (^o): 38.88
  • Long. (^o): -120.64

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009642	Metagenome / Metatranscriptome	315	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12053J15887_101054072	F009642	AGGGGG	MGKVNADRAEKVGDFLFRYMRARHRFKEKVEGPLPRSQLATLIGLGKQEFDEIYVEPEANPPIVLDGKAGDVFDAIINKKYRAIPFWDAQLVAAWRNHVVNDGPMPRKPGPRQAXAXHDGHLTPHDHAD*