| Basic Information | |
|---|---|
| Taxon OID | 3300001605 Open in IMG/M |
| Scaffold ID | Draft_10613752 Open in IMG/M |
| Source Dataset Name | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 557 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fort McMurray in northeastern Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 57.01116 | Long. (o) | -111.6 | Alt. (m) | Depth (m) | 0 to .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029455 | Metagenome / Metatranscriptome | 188 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Draft_106137523 | F029455 | GAG | MPDRIIDLDLWEDGNANQIPAITVTPSGLHLEGSTAEFDRLLLIMGGWLKP* |
| ⦗Top⦘ |