Scaffold Draft_10152307

Overview

Basic Information

• Taxon OID: 3300001592
• Scaffold ID: Draft_10152307
• Source Dataset Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2:
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 972
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Medicine Hat, Alberta, Canada
• Coordinates
  • Lat. (^o): 50.033333
  • Long. (^o): -110.666667
  • Depth (m): 800

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037272	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Draft_101523073	F037272	GAGG	MTSPQIMRVHTAAGIEDIDADRLLVEYDEYVLLRGDEEIRRVKIADVVSDIDPDTGEEIGGIQTIYSRS*