Basic Information | |
---|---|
Taxon OID | 3300001592 Open in IMG/M |
Scaffold ID | Draft_10075563 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1766 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Medicine Hat, Alberta, Canada | |||||||
Coordinates | Lat. (o) | 50.033333 | Long. (o) | -110.666667 | Alt. (m) | Depth (m) | 800 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050360 | Metagenome / Metatranscriptome | 145 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_100755635 | F050360 | GAG | MNTEQVVHNNMLREIEGMSYGGDVQDDVSDWTDVNTYLPEFSRMVWAACPNAVLCAYQTFLLYLDSDGQWRDNTGCLFSRKVNFWQYADVPECNVSC* |
⦗Top⦘ |