Basic Information | |
---|---|
Taxon OID | 3300001592 Open in IMG/M |
Scaffold ID | Draft_10050445 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2502 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Medicine Hat, Alberta, Canada | |||||||
Coordinates | Lat. (o) | 50.033333 | Long. (o) | -110.666667 | Alt. (m) | Depth (m) | 800 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089495 | Metagenome / Metatranscriptome | 109 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_100504456 | F089495 | N/A | MGRPYLRKSHVAVRFYDGTETTPYTLDITGYSDIPELPEPVIDVAAEPYVVGGNFNSIEEGDDAVTLPEFAITIDINDADVASGKYAIDQWFANHKEGTGTTALVSTNDGSAYLKKSIDGTTTSANLSTDYFTIGMKVLFDNGGTGKAFGKDFKYIRPIDAKFSTSGKAQVTIRGQILGAPTDITAL* |
⦗Top⦘ |