NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_10008654

Scaffold Draft_10008654


Overview

Basic Information
Taxon OID3300001592 Open in IMG/M
Scaffold IDDraft_10008654 Open in IMG/M
Source Dataset NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2:
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9539
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (70.59%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameMedicine Hat, Alberta, Canada
CoordinatesLat. (o)50.033333Long. (o)-110.666667Alt. (m)Depth (m)800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011936Metagenome / Metatranscriptome285Y
F048174Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
Draft_1000865410F048174GAGMSDKGQLNNKDVQSHSEVVEALLKGEIERLKEDLDRLHRERDSFQRQCAVMSEENAIWEAESKRLDWMVKNRGRIEWEFGGNCYVTFIHKNDFKATLGSDDTRVEIDRAMEMCK*
Draft_100086542F011936AGGLLEQLHETRLQKLEQGHDMLSRDYSRLNDAIVKISESLTALVVIQEQNKSIMQHVERNSTLIEKSSSRIDEIERHQPQLLELRTWVLTGLGLIVSAVVVAMIALVIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.