NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24005J15628_10076721

Scaffold JGI24005J15628_10076721


Overview

Basic Information
Taxon OID3300001589 Open in IMG/M
Scaffold IDJGI24005J15628_10076721 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1189
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000499Metagenome / Metatranscriptome1074Y
F004086Metagenome / Metatranscriptome454Y

Sequences

Protein IDFamilyRBSSequence
JGI24005J15628_100767211F004086N/AVLMLDYSKGFTDVNTTDNSLIKSFSDIETESYRLAYEIQKDTHTTFGWSFSLPSHITSGTMDLEVAESVNLDGTINYTDINSNLTQGTKEKNIGFYYNKSGEEELDASFNFTAEYRMDKSGVANNDGVEVGMSFVKKFAGSCKFLWMKNPKCFDKNGKMKADLFGKTVRK*
JGI24005J15628_100767212F000499AGGMQKEIYNENYFGTLMCILVDESRRIMSTFNPTPELHKFQNDMCKAGSWIDSMPIGTIVETVPQSSMQKLQADALPEYRRLAANLIDQFINEFEAQGGRRTEITEKFERMYKWRQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.