Scaffold JGI12009J15757_108239

Overview

Basic Information

• Taxon OID: 3300001574
• Scaffold ID: JGI12009J15757_108239
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0262
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 523
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -3.03
  • Long. (^o): -27.33
  • Depth (m): 4002.04

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012354	Metagenome	281	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12009J15757_1082392	F012354	N/A	ANIPKPIPIAKKAIDILNNVGLPVFLNPIYEIVPITRPTNSPTKFRIISRKNSNYADSATVLNKVSEVLPNLE*