Scaffold JGI20215J15232_1006871

Overview

Basic Information

• Taxon OID: 3300001547
• Scaffold ID: JGI20215J15232_1006871
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site C1 Bulk
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1708
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Twitchell Island, Sacramento and San Joaquin Delta, California, USA
• Coordinates
  • Lat. (^o): 38.1075
  • Long. (^o): -121.6497
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011857	Metagenome / Metatranscriptome	286	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20215J15232_10068714	F011857	N/A	EKVIGTNCFNCKFIANNNEPVVLKELNNEGGIDPKNQDEMNRAEIADLITLPGGSKTDADTKRLCYNKKIEMYVTKRMCCAYWDNDGVKRPWKKQ*