Scaffold JGI20163J15578_10559422

Overview

Basic Information

• Taxon OID: 3300001544
• Scaffold ID: JGI20163J15578_10559422
• Source Dataset Name: Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 703
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Kakamega Forest, Kenya
• Coordinates
  • Lat. (^o): 0.2917
  • Long. (^o): 34.856

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003173	Metagenome	503	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20163J15578_105594222	F003173	GGA	METNVEKTKVIRISRQPSPVTIMIDQKQLENVERFKYLGSVLTNDGRCECEIKSRITMAKAAFNQ*