| Basic Information | |
|---|---|
| Taxon OID | 3300001538 Open in IMG/M |
| Scaffold ID | A10PFW1_11659255 Open in IMG/M |
| Source Dataset Name | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 591 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Axel Heiberg Island, Nunavut, Canada | |||||||
| Coordinates | Lat. (o) | 79.26 | Long. (o) | -90.46 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F086949 | Metagenome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| A10PFW1_116592551 | F086949 | N/A | MLEVEVAANAMYAWAAERILERRLPGERPADPAEYAAAVRMAAQELRYQSHERLMRAFLGPEVFEGAVVVVRPPRAAAEQLRLVSG* |
| ⦗Top⦘ |