Scaffold A10PFW1_10661258

Overview

Basic Information

• Taxon OID: 3300001538
• Scaffold ID: A10PFW1_10661258
• Source Dataset Name: Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1158
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)

Source Dataset Sampling Location

• Location Name: Axel Heiberg Island, Nunavut, Canada
• Coordinates
  • Lat. (^o): 79.26
  • Long. (^o): -90.46

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093596	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
A10PFW1_106612583	F093596	N/A	IRMVVPGRIVRDAALGGLSLRRSRNARFLFVSVTNRGNVNLPLRGRVTASLLRRGQRLAQLSPRGRRALLPGARAVLALRYGGRVRGLLTAVIRIRLGPGVRAVERRYRVRL*