| Basic Information | |
|---|---|
| Taxon OID | 3300001533 Open in IMG/M |
| Scaffold ID | MLSed_10027165 Open in IMG/M |
| Source Dataset Name | Benthic freshwater microbial communities from British Columbia, Canada |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5690 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (63.64%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic → Benthic Freshwater Sediment Microbial Communities From British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 49.283333 | Long. (o) | -119.583333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F086282 | Metagenome | 111 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MLSed_100271656 | F086282 | AGGA | MLILNQINSLSKRLSSNLVIYRHCPVCHRHGAHRHGAYRRTLPDSAVRKVSVPRFLCLHCRKTFSCLPFSLVRRLGVSLPDLLKCATSTEPWAVLEETLMIARSTLWRWRRLGKKLLAVMAELLDLANNSWVEASHIISRIQYPSLLRKSRPTQAGN* |
| ⦗Top⦘ |