Scaffold Abe_1164519

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Abe_1164519

Scaffold Abe_1164519

Overview

Basic Information
Taxon OID	3300001524 Open in IMG/M
Scaffold ID	Abe_1164519 Open in IMG/M
Source Dataset Name	Abe Hydrothermal Plume
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1006
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean (2)

Source Dataset Sampling Location
Location Name	Abe
Coordinates	Lat. (^o)	-21.0	Long. (^o)	176.0	Alt. (m)		Depth (m)	2100
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005580	Metagenome	396	Y

Sequences

Protein ID	Family	RBS	Sequence
Abe_11645193	F005580	AGGAG	MKAIPHPSVTGLASGLAIAAYLNSGVETTTRTGTSLGTIKTMGEGVIKDITDGQLGQAFNTLSSNAISMIASDGGRKTLVTAGGIAILGAFARKQFPQLKLGGSKLYFRL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.