Scaffold Abe_1115901

Overview

Basic Information

• Taxon OID: 3300001524
• Scaffold ID: Abe_1115901
• Source Dataset Name: Abe Hydrothermal Plume
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 931
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → Circular genetic element sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean (2)

Source Dataset Sampling Location

• Location Name: Abe
• Coordinates
  • Lat. (^o): -21.0
  • Long. (^o): 176.0
  • Depth (m): 2100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035722	Metagenome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Abe_11159011	F035722	N/A	MTLAASKSVSRAKGGNIYGWSGSQALSASGVTLLSYTNPSAFYLTRITLGVDWSGISATEFISYTINVDGVALFVEKTI