Basic Information | |
---|---|
Taxon OID | 3300001524 Open in IMG/M |
Scaffold ID | Abe_1111979 Open in IMG/M |
Source Dataset Name | Abe Hydrothermal Plume |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 912 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean (2) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Abe | |||||||
Coordinates | Lat. (o) | -21.0 | Long. (o) | 176.0 | Alt. (m) | Depth (m) | 2100 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033074 | Metagenome | 178 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Abe_11119791 | F033074 | AGGAGG | MPHLTPDTSPGLRVPSQIKVLPTANVLDYGQDVSLHLTTVGMTEQAITFSTAAITRSLDEGGQPLDAFPHVYSDIDDGLLLHEGNDTTFDTDYVFNSDMIAVVYKLSVNVCMGLNVSAYTSGNFNLGDLVVTVTEQGGSKRNIYTNTFQSGAANLAGTGTSLHWFTVDIVQPFQIFPNQPITVNLKLNTTLATGTSQAGIVSVAPFLNTAVMKSFNES |
⦗Top⦘ |