| Basic Information | |
|---|---|
| Taxon OID | 3300001524 Open in IMG/M |
| Scaffold ID | Abe_1050352 Open in IMG/M |
| Source Dataset Name | Abe Hydrothermal Plume |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1479 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean (2) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Abe | |||||||
| Coordinates | Lat. (o) | -21.0 | Long. (o) | 176.0 | Alt. (m) | Depth (m) | 2100 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097497 | Metagenome / Metatranscriptome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Abe_10503522 | F097497 | N/A | MPKKPRKRTTPKQRDPSWQLRHALGHKVEIDPKAYTRKLKHPEEIEDPEEP* |
| ⦗Top⦘ |