| Basic Information | |
|---|---|
| Taxon OID | 3300001522 Open in IMG/M |
| Scaffold ID | Mariner_1134543 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 723 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tui Malila, Pacific Ocean, Of Black Smokers |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mariner, ELSC, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -20.064428 | Long. (o) | -176.171974 | Alt. (m) | Depth (m) | 1900 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029745 | Metagenome | 187 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Mariner_11345432 | F029745 | AGGA | MGRKCPRVGDIVKSRVTTESVAGFITATEGIHVWVRFFDTKFEDGDFWDVHSRRDTLEVISSANSS* |
| ⦗Top⦘ |