| Basic Information | |
|---|---|
| Taxon OID | 3300001522 Open in IMG/M |
| Scaffold ID | Mariner_1112731 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1398 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tui Malila, Pacific Ocean, Of Black Smokers |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mariner, ELSC, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -20.064428 | Long. (o) | -176.171974 | Alt. (m) | Depth (m) | 1900 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016735 | Metagenome | 245 | Y |
| F074128 | Metagenome | 120 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Mariner_11127312 | F016735 | GAG | MTDQMFFLVWFLSFGLYLVIYTWWIPIRTRKNIEAWLMDSESDETLLASLEVITTKIREQVLVDFEEFMLPQARDSFKNFWNGAMGNAAQELSKTEEGSQLSLMHGVASELKDQPWYVQAAASKILPLISKAAESQGDATSTPLKGLGIAK* |
| Mariner_11127314 | F074128 | N/A | QVLLLSHPHPDYSSLDKKGKRLTWRTNCHVVRVTIMDLFSKADDTTAEFVSDWYEHTWTIECREDGNIWVEG* |
| ⦗Top⦘ |