Basic Information | |
---|---|
Taxon OID | 3300001522 Open in IMG/M |
Scaffold ID | Mariner_1092566 Open in IMG/M |
Source Dataset Name | Hydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 791 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tui Malila, Pacific Ocean, Of Black Smokers |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mariner, ELSC, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.064428 | Long. (o) | -176.171974 | Alt. (m) | Depth (m) | 1900 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040399 | Metagenome | 162 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Mariner_10925661 | F040399 | AGGA | MSQVVLFFLFMLVELCAILLLYQMVIIPRIALKTNN |
⦗Top⦘ |