Scaffold Mariner_1089716

Overview

Basic Information

• Taxon OID: 3300001522
• Scaffold ID: Mariner_1089716
• Source Dataset Name: Hydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 525
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tui Malila, Pacific Ocean, Of Black Smokers

Source Dataset Sampling Location

• Location Name: Mariner, ELSC, Pacific Ocean
• Coordinates
  • Lat. (^o): -20.064428
  • Long. (^o): -176.171974
  • Depth (m): 1900

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053548	Metagenome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Mariner_10897161	F053548	GAG	VKSSGAPSIGDIVIALYDEERGVTCVGLVMETKGIECKVLWSSENNPIGWWPRQSLKVIGAA*