NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Mariner_1075634

Scaffold Mariner_1075634


Overview

Basic Information
Taxon OID3300001522 Open in IMG/M
Scaffold IDMariner_1075634 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1469
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tui Malila, Pacific Ocean, Of Black Smokers

Source Dataset Sampling Location
Location NameMariner, ELSC, Pacific Ocean
CoordinatesLat. (o)-20.064428Long. (o)-176.171974Alt. (m)Depth (m)1900
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014466Metagenome263Y

Sequences

Protein IDFamilyRBSSequence
Mariner_10756342F014466GGTGGMAYTIKDVFYLSTSAIIASGTANGGSAQLDLSAYIDPIARGRQKGTGLAVYKTYYSMGQSSKGEPIDDAEAGSCRFGLLAGAGLGDTATGDIVPSTEGFAMTNALLVSSGDFYGPKSMVANASPPAAGLMTESQYVMPSTEVPYVIVRDNVCLVYAVGDNFTSGAVLSVRLEVAQITLDQATLNQLLRTQTV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.