Scaffold KiloMoana_1055772

Overview

Basic Information

• Taxon OID: 3300001515
• Scaffold ID: KiloMoana_1055772
• Source Dataset Name: Hydrothermal vent plume microbial communities from Kilo Moana, Pacific Ocean, of black smokers
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 847
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Kilo Moana, Pacific Ocean, Of Black Smokers

Source Dataset Sampling Location

• Location Name: Kilo Moana, ELSC, Pacific Ocean
• Coordinates
  • Lat. (^o): -20.064428
  • Long. (^o): -176.171974
  • Depth (m): 2600

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015490	Metagenome	254	Y

Sequences

Protein ID	Family	RBS	Sequence
KiloMoana_10557723	F015490	N/A	VRISMSCTPQMDSNTDGISVFKYAGDGVSVQQIFSGPAWSCQAAGPLGGNSAGPVVMESSTGLFDIIPGNQIDFSVAVTTAETCDVAVSITYSA*