Basic Information | |
---|---|
Taxon OID | 3300001515 Open in IMG/M |
Scaffold ID | KiloMoana_1055772 Open in IMG/M |
Source Dataset Name | Hydrothermal vent plume microbial communities from Kilo Moana, Pacific Ocean, of black smokers |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 847 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Kilo Moana, Pacific Ocean, Of Black Smokers |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kilo Moana, ELSC, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.064428 | Long. (o) | -176.171974 | Alt. (m) | Depth (m) | 2600 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015490 | Metagenome | 254 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
KiloMoana_10557723 | F015490 | N/A | VRISMSCTPQMDSNTDGISVFKYAGDGVSVQQIFSGPAWSCQAAGPLGGNSAGPVVMESSTGLFDIIPGNQIDFSVAVTTAETCDVAVSITYSA* |
⦗Top⦘ |