Scaffold JGI20161J15289_1012429

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20161J15289_1012429

Scaffold JGI20161J15289_1012429

Overview

Basic Information
Taxon OID	3300001474 Open in IMG/M
Scaffold ID	JGI20161J15289_1012429 Open in IMG/M
Source Dataset Name	Cubitermes ugandensis crop segment gut microbial communities from Kakamega Forest, Kenya - Cu122C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	513
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	Kakamega Forest, Kenya
Coordinates	Lat. (^o)	0.2917	Long. (^o)	34.856	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039865	Metagenome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20161J15289_10124291	F039865	AGG	MNQYFKKQLKTPTCFGSFGIHPQGVLKRDSLKLLE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.