NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24004J15324_10000715

Scaffold JGI24004J15324_10000715


Overview

Basic Information
Taxon OID3300001472 Open in IMG/M
Scaffold IDJGI24004J15324_10000715 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-32
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13306
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (4.88%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.2833Long. (o)-134.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044736Metagenome / Metatranscriptome154Y
F070657Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
JGI24004J15324_1000071513F044736N/AMNKIEKIQNQVTINWNSKSSYDAELMFNINSNXPVITVDEYFEMNNLHAEFEEGCEKLGYKLPYNK*
JGI24004J15324_100007153F070657N/AMTVLRFFKDGLTGDECAIAWNGTEEICITEAQAYDILAEEQAQQNSYENGLLFH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.