Scaffold JGI20162J15292_1001823

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20162J15292_1001823

Scaffold JGI20162J15292_1001823

Overview

Basic Information
Taxon OID	3300001468 Open in IMG/M
Scaffold ID	JGI20162J15292_1001823 Open in IMG/M
Source Dataset Name	Cubitermes ugandensis midgut segment microbial communities from Kakamega Forest, Kenya - Cu122M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	977
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	Kakamega Forest, Kenya
Coordinates	Lat. (^o)	0.2917	Long. (^o)	34.856	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068978	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20162J15292_10018232	F068978	N/A	FLNFLVYLSEVENSKYGTRNTSTTGSTNGMSLILSNNQAIGVTEEVREITWFHK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.