Scaffold JGI12363J15224_100380

Overview

Basic Information

• Taxon OID: 3300001464
• Scaffold ID: JGI12363J15224_100380
• Source Dataset Name: Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6993
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location

• Location Name: Browns Valley, California, USA
• Coordinates
  • Lat. (^o): 39.23550963
  • Long. (^o): -121.2836963

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019549	Metagenome	229	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12363J15224_1003802	F019549	AGG	MATAFSNSIESIAPSCEDAMQEPASVQASSRVFSSDADSVVLIGSRLLTFEAMHLLISLDRDLREARAQWNQDWFRRLLRIRPKAVSRLRRRWAKLDPPPAIPLGTLRRRYHANLAKYLYQPTGGLNG*