NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12363J15224_100101

Scaffold JGI12363J15224_100101


Overview

Basic Information
Taxon OID3300001464 Open in IMG/M
Scaffold IDJGI12363J15224_100101 Open in IMG/M
Source Dataset NameForest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19952
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (78.26%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameBrowns Valley, California, USA
CoordinatesLat. (o)39.23550963Long. (o)-121.2836963Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031997Metagenome181Y

Sequences

Protein IDFamilyRBSSequence
JGI12363J15224_1001015F031997N/AMAVTFASRWIEKVGHGCWLADVLILKAIAQARLGKPARAQITLQRAIEVAHEADALNKAGLAALTMIEEVDPLSPETLQAAYQQAREWLADSQSRDVLSRLSAAGGKLADSLCKEMSRDQAVDVLLPKPLNLDQRLLECEHETIKQALAQTNGSVVHAAPLIGRTYQGLSHMIETKHPDLLNTRTPIRRRKRRKKAGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.