| Basic Information | |
|---|---|
| Taxon OID | 3300001463 Open in IMG/M |
| Scaffold ID | JGI24021J15306_10037744 Open in IMG/M |
| Source Dataset Name | Ecteinascidia turbinata endosymbiont from Florida, USA - Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5362 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (7.69%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Tenebrionoidea → Tenebrionidae → Tenebrioninae → Tenebrio → Tenebrio molitor | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Tunicates → Ascidians → Unclassified → Unclassified → Ecteinascidia Turbinata → Ecteinascidia Turbinata Symbiotic Microbial Communities From The Caribbean Mangrove |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Key West, Florida, United States | |||||||
| Coordinates | Lat. (o) | 24.5512 | Long. (o) | -81.8083 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028032 | Metagenome | 193 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24021J15306_100377441 | F028032 | N/A | ANMKRKYMNIDNAQWKEPELTTLISEVGGITNMQSMHARVLQYQM* |
| ⦗Top⦘ |