Scaffold JGI24006J15134_10016210

Overview

Basic Information

• Taxon OID: 3300001450
• Scaffold ID: JGI24006J15134_10016210
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-53
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3518
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (58.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 49.5666
  • Long. (^o): -138.6666

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037292	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24006J15134_1001621011	F037292	GGAGG	MSNKEYQKSVWYKIERYFDRHNHLMEFIRTILALVTITLQLVILSKIV*