Scaffold JGI20219J14954_1009305

Overview

Basic Information

• Taxon OID: 3300001448
• Scaffold ID: JGI20219J14954_1009305
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk Metatranscriptome
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 594
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Twitchell Island, Sacramento and San Joaquin Delta, California, USA
• Coordinates
  • Lat. (^o): 38.107
  • Long. (^o): -121.6475
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085747	Metagenome / Metatranscriptome	111	N

Sequences

Protein ID	Family	RBS	Sequence
JGI20219J14954_10093051	F085747	N/A	FQVICLAAKLSAGILGTELREQKRRTVSGLLPGTPLXVRRINAPRAVCWPNSVLSRRLVATFHSPGTTACFQATIPRSKLPAYYFNALPNRCSGPFDRSLLRPNRFAPGPVGIIADGPFPGIRLGTFETASDLHSPLGVPAPAGSKRSTRFGSEKPTFRLRPIVLRSPQSFYLIVSITDHRSELATFPEARCSRSEE