| Basic Information | |
|---|---|
| Taxon OID | 3300001425 Open in IMG/M |
| Scaffold ID | yes_10531815 Open in IMG/M |
| Source Dataset Name | Goat rumen bacterial communities from Langston, Oklahoma, USA - velvet |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Cornell University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 752 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Goat Rumen → Goat Rumen Microbial Communities From Langston University, Oklahoma, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Langston, Oklahoma, USA | |||||||
| Coordinates | Lat. (o) | 35.453976 | Long. (o) | -97.515884 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056169 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| yes_105318152 | F056169 | AGGA | MTAKEAIFEARKYGLEEEIRQELAAGLSPEEALEEWDIF |
| ⦗Top⦘ |