Scaffold yes_10331833

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold yes_10331833

Scaffold yes_10331833

Overview

Basic Information
Taxon OID	3300001425 Open in IMG/M
Scaffold ID	yes_10331833 Open in IMG/M
Source Dataset Name	Goat rumen bacterial communities from Langston, Oklahoma, USA - velvet
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Cornell University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	524
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Goat Rumen → Goat Rumen Microbial Communities From Langston University, Oklahoma, Usa

Source Dataset Sampling Location
Location Name	Langston, Oklahoma, USA
Coordinates	Lat. (^o)	35.453976	Long. (^o)	-97.515884	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019925	Metagenome / Metatranscriptome	227	N

Sequences

Protein ID	Family	RBS	Sequence
yes_103318331	F019925	N/A	NQTNQQYLSLTSHKSNLKKITTGTWKDLLDLKVECPNRGVLKNFVLRKDSTNIWYDFQCYSSEDYSNDEGEPIIKGLALSSAYKYDISIQENIRTLSDYPIECWVDYGLSSFMLYNDNGLKRDATCYGLKAKYTSKIAIKTATGKALATKIDGLVGITVGSTEQETDDNICLLY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.