Basic Information | |
---|---|
Taxon OID | 3300001419 Open in IMG/M |
Scaffold ID | JGI11705J14877_10016747 Open in IMG/M |
Source Dataset Name | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3007 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Greece: Etoliko Lagoon | |||||||
Coordinates | Lat. (o) | 38.4825 | Long. (o) | 21.315 | Alt. (m) | Depth (m) | 15 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021211 | Metagenome / Metatranscriptome | 220 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI11705J14877_100167475 | F021211 | N/A | NMAKEKKVDLRQEAETKMETLVEQHNTLVGEIQEAQGRLGEVKQMIVEHQGYMKGLEACKEDCEVK* |
⦗Top⦘ |