| Basic Information | |
|---|---|
| Taxon OID | 3300001392 Open in IMG/M |
| Scaffold ID | Lau_10023088 Open in IMG/M |
| Source Dataset Name | ELSC Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1706 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From The Eastern Lau Spreading Center |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kilo Moana - ELSC (Lau Basin) | |||||||
| Coordinates | Lat. (o) | -20.0 | Long. (o) | 176.0 | Alt. (m) | Depth (m) | 2600 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052865 | Metagenome / Metatranscriptome | 142 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Lau_100230882 | F052865 | N/A | MDLRNLGIVVLGLGLPSIAGWMTSTGVGGRVMSYVDMVPGMSTNVGKAVGAVALTAGVSYLAATWGIISATEALTANMIALGLVTVGVLQTMSLPVGGNFVSALPSAGGLAGLGASYGYIGNYHEGVGAELLPQPASGQIFGVKANVF* |
| ⦗Top⦘ |