| Basic Information | |
|---|---|
| Taxon OID | 3300001392 Open in IMG/M |
| Scaffold ID | Lau_10007197 Open in IMG/M |
| Source Dataset Name | ELSC Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3398 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From The Eastern Lau Spreading Center |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kilo Moana - ELSC (Lau Basin) | |||||||
| Coordinates | Lat. (o) | -20.0 | Long. (o) | 176.0 | Alt. (m) | Depth (m) | 2600 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040399 | Metagenome | 162 | Y |
| F106170 | Metagenome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Lau_100071972 | F106170 | N/A | MLEVSYAYDKPLYFIELRSCPDMGERKPLSFGPSERYLPALKEGDALTFQLNDIGVDVDTEFGEKLQFSLRVINTAVSSSSSIKEGTYVWNTTCRAAKDLHEYFIDQDMETCEWTFVLKAEEYGYSIKEIA* |
| Lau_100071979 | F040399 | AGGAG | MSQAIMFLLFMAAELIAILLLYQMVIIPRVAEKTNNLFEQRMLDKTWDIPAMLEDYTIHLADVFGAVIKKLVPEIMGGYMSAGV |
| ⦗Top⦘ |