| Basic Information | |
|---|---|
| Taxon OID | 3300001386 Open in IMG/M |
| Scaffold ID | MG2b_10023 Open in IMG/M |
| Source Dataset Name | Cayman MG2b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 23783 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid Cayman Rise | |||||||
| Coordinates | Lat. (o) | 18.43001 | Long. (o) | -81.46999 | Alt. (m) | Depth (m) | 4953 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005684 | Metagenome / Metatranscriptome | 393 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MG2b_1002311 | F005684 | AGGAGG | VYDTEESPLSAMQVVRRESEVREGRLCNRNEPRQAHCEPERGRFPDRGWNEHPRRSKSKQVRMASTGPGRMHS* |
| ⦗Top⦘ |