Scaffold JGI20127J14776_1021158

Overview

Basic Information

• Taxon OID: 3300001382
• Scaffold ID: JGI20127J14776_1021158
• Source Dataset Name: Hot spring sediment microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC3_ASED
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 849
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Joseph's Coat, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051572	Metagenome / Metatranscriptome	144	N

Sequences

Protein ID	Family	RBS	Sequence
JGI20127J14776_10211582	F051572	GAGG	MSSGRVHGGPFAEMWTFADVVLKGGCKKSVQFLNTRLELCVLAALIKTAPAGSMVKLRPEIVRSLVEELAAAAGRDRERIRNALLKKAGEVLAQLRRELGGKTPAEALLAKLAELFLKELEA*