Scaffold YBMDRAFT_10093266

Overview

Basic Information

• Taxon OID: 3300001373
• Scaffold ID: YBMDRAFT_10093266
• Source Dataset Name: YB-Mouth-sed
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1530
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Youngs Bay mouth
• Coordinates
  • Lat. (^o): 46.17469
  • Long. (^o): -123.84933
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050782	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
YBMDRAFT_100932661	F050782	N/A	MGYAGSADIFRAEMMKLMEALEYVRAYIDDLLVITRGTL*