Scaffold YBBDRAFT_1203950

Overview

Basic Information

• Taxon OID: 3300001372
• Scaffold ID: YBBDRAFT_1203950
• Source Dataset Name: YB-Back-sed
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 596
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Youngs Bay mouth
• Coordinates
  • Lat. (^o): 46.15968
  • Long. (^o): -123.80651
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015265	Metagenome / Metatranscriptome	256	Y

Sequences

Protein ID	Family	RBS	Sequence
YBBDRAFT_12039501	F015265	N/A	IEKNAIVNLNNVGLPVFLNPINDIIPMISPTKNPTKFSIFSNRNSNDV*