| Basic Information | |
|---|---|
| Taxon OID | 3300001371 Open in IMG/M |
| Scaffold ID | BBDRAFT_10159236 Open in IMG/M |
| Source Dataset Name | Baker-B-sed |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of South Carolina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 745 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baker Bay | |||||||
| Coordinates | Lat. (o) | 46.28551 | Long. (o) | -124.05187 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066277 | Metagenome | 127 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BBDRAFT_101592362 | F066277 | N/A | MDRKKFVALFSTSLLGVALLKANPLNFFAPKSNSKGSNSVKVKINPNAVNREKSGKKNG* |
| ⦗Top⦘ |